PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7162_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 169aa    MW: 19526.2 Da    PI: 10.3192
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7162_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822121.11.5e-3736109376
                               DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 
                                          + r p++kEr nnk+RER+RRai+  i+aGLRa+Gny+lpk  D n+ l+ALc+eAGw ve+DGt yrk + p+
  cra_locus_7162_iso_1_len_1220_ver_3  36 KLRFPSEKERLNNKQRERKRRAITHNIFAGLRAHGNYQLPKNPDSNDLLRALCEEAGWHVEEDGTIYRKVTWPP 109
                                          6799*****************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-3437110IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045492Biological Processxylan biosynthetic process
GO:0005794Cellular ComponentGolgi apparatus
GO:1990538Molecular Functionxylan O-acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGEEYERNSV LRGCIKKTKG PWVVRRATKN RGTVTKLRFP SEKERLNNKQ RERKRRAITH  60
NIFAGLRAHG NYQLPKNPDS NDLLRALCEE AGWHVEEDGT IYRKVTWPPF SLFPSPVVIF  120
GFKNLILASI FXQEPALKAP NLMEMDSSFQ ALVDDQNYCT QGMIKWKSP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095225.13e-53PREDICTED: beta-amylase 7-like
TrEMBLA0A068UD638e-53A0A068UD63_COFCA; Uncharacterized protein